SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22299735|ref|NP_682982.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299735|ref|NP_682982.1|
Domain Number 1 Region: 346-501
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.26e-16
Family HD domain 0.015
Further Details:      
 
Weak hits

Sequence:  gi|22299735|ref|NP_682982.1|
Domain Number - Region: 627-705
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0719
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22299735|ref|NP_682982.1|
Sequence length 727
Comment glycyl-tRNA synthetase subunit beta [Thermosynechococcus elongatus BP-1]
Sequence
MPHSSLHTFLLEVGTEDLPARFVSSALRQWRTLIPQTLKERGLTGEVNVWATPRRLAVLI
EGLPPQQPDQVVEIKGPAATVAFREGEPTPALLGFLRSRQGSLEDIEIRPTAKGEVVYLK
QVRPGQPTPQLLSELAQQWIAALEGPRFMRWGDGDLRFSRPIRWLVLLWDERVLPLVLES
HSVAIASDRTTYGHRVLSQGAIVLSHAQDYATALEKAGVLVDPEVRQQRIREQIAALAAE
AGGWTDLEVPLLEEVTHLVEWPTAVLGSFEARFLALPLEVITTVLVSHQRYFPVYTDATR
QALLPVFITISNGAPAATPLIRGGNERVIRARLADAEFFYKADTAQPLEHYCGKLATVTF
QDELGSMADKVERLTALARQIATALNCTAAEVAAIERTASLCKADLVTQMVGEFPELQGY
MGQVYATVSGEAPAVATGIFEHYLPRFAGDRQPQSLTGQVVGLADRLDTLVSLFGLGLCP
TGSSDPFALRRAANGVITILWQGEHHLNLLALLQEYAQAFCRQFAAKLSAADLEQQLRQF
FSQRLRTLLQEDLGIEYDLVNAVIPEDQPELQIRALRDVVDARDRAQFLQKLRQSGELMA
IYPTVNRAARLARQGTLGTDCLNIRAVKAKHLETPIEKEFYAALKDILPTVQQAQGQRAY
GAIVDALVSLAPIVSRFFDGEESVLVMAEDATVRANRLALLGLLRNCAAIIGDFGAIVQT
ESSPSAP
Download sequence
Identical sequences Q8DGX0
NP_682982.1.97157 197221.tll2192 gi|22299735|ref|NP_682982.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]