SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22299830|ref|NP_683077.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|22299830|ref|NP_683077.1|
Domain Number - Region: 27-115
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 0.051
Family Prokaryotic type I DNA topoisomerase 0.012
Further Details:      
 
Domain Number - Region: 144-210
Classification Level Classification E-value
Superfamily CorA soluble domain-like 0.0562
Family CorA soluble domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22299830|ref|NP_683077.1|
Sequence length 385
Comment hypothetical protein tlr2287 [Thermosynechococcus elongatus BP-1]
Sequence
MLFRPYKPIYIGGKQVPFTPGLIPRNQERLARRIADAILGSLLTPEELQNLARRLLQVQR
VKAVIHWLLQTSLSQIQAQSEQRSAQVLANILRDFFGSALPRLMKVWSRREDFLEPQLNQ
LFDQVLVELQLSDEQAEKLADWLLSVMLPPDRLRLAIIDFLTDRTINVLDQELRQNTSGT
YWVVANLVGVRNTLIRLREYCLNEREACNRRLGDLITALALRQRLVEALQNLTLQSLPLG
TVRELRQLFRQTVRSYIQEQGASVIETVSQTVEWETISLSILRRLRDSASLGASLEVVSD
ELALVLDRYLERDMELIVERAIPILDLDRVIVDRVKATSPENLELAIQGIVRSELQAIVR
LGGILGFLIGVVQAGVLYWQSLQVP
Download sequence
Identical sequences 197221.tlr2287 NP_683077.1.97157 TeR231 gi|22299830|ref|NP_683077.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]