SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22299891|ref|NP_683138.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|22299891|ref|NP_683138.1|
Domain Number - Region: 10-61
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.000867
Family Chaperone J-domain 0.0072
Further Details:      
 
Domain Number - Region: 100-146
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00219
Family Pyruvate oxidase and decarboxylase Pyr module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22299891|ref|NP_683138.1|
Sequence length 210
Comment hypothetical protein tlr2348 [Thermosynechococcus elongatus BP-1]
Sequence
MSKDQFAMSDNPYEKLQVPEDASFEQIKEARDALLAAHSGDERQRTEIEAAYDAILMDRL
RQRQEGKIKVPERIRYAEELKEPAPAKLNRIANHPALQWWQQQLDTPNLRGIAITSTIYA
VLMAIGLAQANPDTLALVLSLGVGFNLVWLQRKEQRLGRAFLITLLALILGSVMAVGLYQ
LGLPGVFLTVDQLVGIGVFVTFWLTSNFLR
Download sequence
Identical sequences Q8DGG9
197221.tlr2348 NP_683138.1.97157 gi|22299891|ref|NP_683138.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]