SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161485769|ref|NP_681412.2| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161485769|ref|NP_681412.2|
Domain Number 1 Region: 2-350
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.12e-78
Family TK-like PP module 0.0066
Further Details:      
 
Domain Number 2 Region: 290-480
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.88e-67
Family TK-like Pyr module 0.016
Further Details:      
 
Domain Number 3 Region: 493-626
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.67e-38
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161485769|ref|NP_681412.2|
Sequence length 638
Comment 1-deoxy-D-xylulose-5-phosphate synthase [Thermosynechococcus elongatus BP-1]
Sequence
MHLSELTHPNQLHGLSIAQLTQIAAQIRDKHLETVAATGGHLGPGLGVVELTLALYQTLD
LEKDRVVWDVGHQAYPHKMLTGRYNNFHTLRQKGGIAGYLNRRESPFDHFGAGHASTSIS
AALGMAIARDLKGENFKVVAIIGDGALTGGMALEAINHAGHLPHTNLMVVLNDNEMSISP
NVGAIPRYLNKIRLSPQVQFITDNLEEQFKHIPFFGENLTPEMQRLKEGMKRLAVPKVGA
VFEELGFTYVGPVDGHNLEELIATFQHAHTIPGPVLVHVATVKGKGYAIAEKDQVGYHAQ
NPFDLVTGKAKPSSKPKPPSYSKVFGETLTKLAENDPRIVGITAAMATGTGLDILQKRVP
KQYIDVGIAEQHAVTMAAGMATQGMRPVAAIYSTFLQRAYDQIVHDVCIQKLPVFFCMDR
AGIVGADGPTHQGMYDIAYLRCLPNMVLMAPKDEAELQRMIVTGINYTDGPIALRYPRGN
GYGVALMEEGWEPLEIGKGELLRSGEDLLLVAYGSMVYPAMQVAEILKEHGMSAAVINAR
FAKPLDTELILPLAKQIGRVVTLEEGCLMGGFGSAVLEALQEADILVPVLRLGVPDILVE
HASPDESKADLGLTPPQMAETIMQKFGVPQRATVVTAS
Download sequence
Identical sequences Q8DL74
197221.tll0623 gi|161485769|ref|NP_681412.2| NP_681412.2.97157 SnR17

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]