SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22297669|ref|NP_680916.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22297669|ref|NP_680916.1|
Domain Number 1 Region: 34-116,206-426
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.29e-28
Family Pectin methylesterase 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22297669|ref|NP_680916.1|
Sequence length 513
Comment hypothetical protein tlr0125 [Thermosynechococcus elongatus BP-1]
Sequence
MKGQPLLFILLVMVLFLMGQPKIAAISASPLALEVNPADPQASDVGKGMPLTPFRTIGAA
LAWAQAHDRPIDIYIHGGIYREALGAIRHRQTPLRLLAKAGDRVILRGSQRWSDWQAVSS
TPNFTIYRHPWTLAWGFSGNPWTAFDIDLPPVAQRGELVWWQKTPLRQRLSFLELQGNDF
YVDDTEQQLYVALPAGVLPSELEVAVHREALRILNSGLISLVGLRFEHYGGTFTQAVRIE
RSHDIEVKDCTFWANNWGGLESHQSNRLRVERTQFLQNGWRGMAGVHLQDFTVQQVLVQG
NNWRGGWAGFYDWDAGEKYFHLRRAVFDHYRAIGNQAAGLWLDTDNQNVKIRRSQFVGNA
VVGLFLEAGTGPVTIEDSLIAYNYSVAPNYLQTPGIFGWAAAHVTLRRNWIWQNQGAQIG
VRDLSPRTLTLPETGEEVTIRSQDWHLEGNWIGSHQEPLLTTLKGEAFLQTLRLEDNHWW
SHAPYPFRLEGENVTWSQWQERYGHPSDRWLLP
Download sequence
Identical sequences Q8DMJ1
NP_680916.1.97157 197221.tlr0125 gi|22297669|ref|NP_680916.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]