SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|551596640|ref|YP_008685933.1| from Desulfovibrio hydrothermalis AM13 = DSM 14728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|551596640|ref|YP_008685933.1|
Domain Number 1 Region: 34-107
Classification Level Classification E-value
Superfamily Fe-only hydrogenase smaller subunit 6.93e-17
Family Fe-only hydrogenase smaller subunit 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|551596640|ref|YP_008685933.1|
Sequence length 112
Comment Iron hydrogenase small subunit [Desulfovibrio hydrothermalis]
Sequence
MNISRRSFIKAAGIMTGYAVLSMNIAKEAVADVMGFVARRQESVYAADANPEVYKYRKSQ
NNPMITKIYDPENGFLHDGPCGHESHELLHTHYIDRSEKLKALKEKGIELNI
Download sequence
Identical sequences L0RFR0
gi|436842756|ref|YP_007327134.1| gi|551596640|ref|YP_008685933.1| WP_015337633.1.21188 WP_015337633.1.81540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]