SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC000210 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  TC000210
Domain Number - Region: 40-80
Classification Level Classification E-value
Superfamily L domain-like 0.00109
Family Ngr ectodomain-like 0.007
Further Details:      
 
Domain Number - Region: 12-49
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0736
Family ATI-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC000210
Sequence length 97
Comment GLEAN_00210
Sequence
MRASVAFVLGIIWVLIVSCEWSCAEPGNDVAHLSFTALRCPRGCTCTGTITDCSHRGFTQ
VPKNIPPETERLFVEFLRLRANLLRFIVSIIIAAKFI
Download sequence
Identical sequences TC000210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]