SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC000218 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC000218
Domain Number 1 Region: 133-382
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.67e-55
Family Glutamine synthetase catalytic domain 0.011
Further Details:      
 
Domain Number 2 Region: 44-131
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0000000000000562
Family Glutamine synthetase, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC000218
Sequence length 385
Comment GLEAN_00218
Sequence
MRLLLTPRILNACKILHRAVHLDWSPNWKLSKKIWDRYRNLPIANCKVQATYVWIDGTGE
NMRSKTRTMDYTPSSHKDCPNLNFNGSYTYQAEPKNSDVILCPIAIYNDPITQGNNKLVL
CETYDTEGRPTPSNHRHHCMETLNHVCDKEPMFGFEQEFMMMDVNSRPFGWPVMSGEPSP
LGSYYCSVGADRAFGREVAESHYRCLLYCGVDISGVNPESTASQWEFKTGPTIGIKAADD
LWISRYLLQRVAEDYGVAISFHPKLFKNWKGSGCHTNFSTKEMREDGGYKYIEEAVKKLE
KRHEDHIKVYDPRGGKYNALRLTGHGVSKVDKFTSGVADSTASVKISKAVMQKQKGHFVD
RRPAANADPYQVMNALVCTLCLNPQ
Download sequence
Identical sequences D6WC56
TC000218 7070.XP_971844 XP_971844.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]