SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC000689 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  TC000689
Domain Number - Region: 228-273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family Laminin-type module 0.039
Further Details:      
 
Domain Number - Region: 532-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0201
Family Laminin-type module 0.027
Further Details:      
 
Domain Number - Region: 641-780
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0267
Family Growth factor receptor domain 0.0053
Further Details:      
 
Domain Number - Region: 278-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0737
Family Laminin-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC000689
Sequence length 993
Comment GLEAN_00689
Sequence
MLHLVLLLPFLISPLAALLEGPNVCTTQESYTTTVRVSEQQPYQVREYVWCLNVPPRCSK
YKIKFKTVYKTQNLVKFRPVDECCKGYTKSSSEDRCIPVCSHDCVHGTCTAPEQCLCESG
YGGPYCDITCPKGLWGRECQNHCECQNNSTCDPFDGTCRCARGWIGTHCEMKCHKGSYGQ
DCAEKCRCVHGECDHVSGECRCSSGWTGPLCDDSCPLGKHGSECKSECRCQNDGTCDPET
GQCFCKPGWTGPVCANRCPFGFWGENCAQPCGCYNGASCHHVTGECECQPGFTGDKCLDT
CPEGTWGLNCSEACACQNGAKCSNLNGQCACSHGWEGKFCEARACPDDFWGYKCKNPCQC
NRDNTEMCHPWTGECICKAGWNSKDCSRPCPLLTYGKGCHGLCKCKNNAQCSPVNGTCLC
PPGFTGDDCGQTCPDNTFGEDCSQKCDCKNGATCSSETGQCQCTAGWEGQQCDRPCSNYS
YGIQCTKQCACKNGASCNPQNGTCTCGAGFTGQFCENKCESGFFGVNCEQRCQCEQGNYI
GCDPVSGKCICKPDWKGVRCESRCPPGKFGPDCKEICNCKNNSSCDPESGKCYCARGWQG
EDCSQPCDKGYYGIGCKEVCPEVSEIAMGNKTCDHITGEYVCPAGYIGITCEHPCPLGTF
GKNCKNNCSCRNGGDCHHVTGECQCLPGWVGKNCTTPCEPGRFGMNCSQHCKCSNKGQCR
RNDGVCKCQPGWTGTQCTEICPEGYYGDHCMAPCECKNDNFVCHPAKGCVCRHGFDGDDC
DTPILLSRVHSTEENSNIGSVIAGVIVAIIAIVAAGCIFVYYRRRVSNLKTEIAHVQYIA
DPSAFSPDRNHFDNPVYSYQGGAKRDNEHLLNNSKTIRNNLHKPTNTNLERARLGVACCS
TDDDDLKGSYCSDELQSLKNREADATNPNIYHSIDKIDHVYDEIKQKDVKDIELEYDHLD
YTRPVTTLKPHYQRMASPFGSRDLTKGDKSETE
Download sequence
Identical sequences D6W8W0
7070.XP_974971 XP_974971.2.52716 TC000689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]