SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC001086 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC001086
Domain Number 1 Region: 208-490
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.16e-79
Family WD40-repeat 0.00000000272
Further Details:      
 
Domain Number 2 Region: 80-193
Classification Level Classification E-value
Superfamily F-box domain 1.44e-23
Family F-box domain 0.00000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC001086
Sequence length 506
Comment GLEAN_01086
Sequence
MMETDKIDDSNSNSQQYPMTILSPYDTARKKEPSATFNAERETCLKCFEKWSETDQVEFV
ENLLARMCHYQHGHINSYLKPMLQRDFISLLPKQGLDHVAENILSYLEADSLRNAELVCK
EWFRVISEGMLWKKLIERKVRTDSLWRGLAERRQWIQYLFKPRPGENHRPHSFYRALFPK
IIRDIESIESNWRNGRHILQRINCRSENSKGVYCLQYDDQKIVSGLRDNTIKIWDRSTLQ
CTKVLIGHTGSVLCLQYDDKVIISGSSDSTVRVWNVNTGEMVNTLIHHCEAVLHLRFNNG
MMVTCSKDRSIAVWDMTSPNEITLRRVLVGHRAAVNVVDFDEKYIVSASGDRTIKVWNTS
TCEFMRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIEGGACLRVLEGHEELVRCIRF
DSKRIVSGAYDGKIKVWDLVAALDPRTPASALCLRTLVEHTGRVFRLQFDEFQIVSSSHD
DTILIWNFLNSIGERNTKSPSPSPFE
Download sequence
Identical sequences D6WA15
TC001086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]