SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC001607 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC001607
Domain Number 1 Region: 29-341
Classification Level Classification E-value
Superfamily L domain-like 9.52e-58
Family Ngr ectodomain-like 0.0073
Further Details:      
 
Domain Number 2 Region: 485-582
Classification Level Classification E-value
Superfamily Immunoglobulin 7.92e-23
Family I set domains 0.023
Further Details:      
 
Domain Number 3 Region: 572-667
Classification Level Classification E-value
Superfamily Immunoglobulin 2.44e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 383-476
Classification Level Classification E-value
Superfamily Immunoglobulin 1.52e-16
Family I set domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC001607
Sequence length 823
Comment GLEAN_01607
Sequence
MVGVCYLATIIIYIISSASCTKSKDCPEICTCLGSYVDCSSKRLQVIPSNLPKWTTHLDL
RNNTIKKLNDVTWRNLTILTELILNKNEISVIPNDAFSNQKQLKILELNRNQLKSIEALT
FKSLERLYVLKLKRNQITQLKDGAFYGLLSIDKLILDYNHILVISKGWLYGLQSLKELSL
NHNYINFVEPEAWEFCKKLALLDLSNNRLESVAANTFKHLNDLQKLVLSNNKITFIEERA
FSHLPNLKYLHLNNNKISWTIEDANGVFQGLGNLIKFYLADNNIKSISKNAFIGLKNVTY
LNLNDNNITSIQMNAFSEVPLLSDLVINTTYLLCDCNIRWFYEWLDTKQFKIRAICAYPE
WLRGQSLVEIPTSNFTCDELPKPRLTEEPEPEIMALKGENITLSCTAMSSSNSPMTFQWK
KDNVDIINMNINENSSSDGKTTEAVSKLNIYRVQHSNAGKYQCVVSNIFGTTYSQKSSIS
VLIFPTFLKRPDNVTVKAGDVAKLVCAAHGEPQPEIAWQKDGGNDFPAARERRMHVLPAD
DSFFISNVKPTDMGIYSCTAHNAAGTIVTNASLTVYEKPSFVKSMENKEVTAGELVVLQC
MASGTPKPTITWYKNGEPIRATERHFFTAEEQLMIIVDTVQSDSGKYECHLNNSLGEKTG
YSLLRVKPGNFTTTDMMGIIIITVVCCAVATSIIWVVIIYQTRRRMPPPAAPPLEGPLEL
DRGVQFTDNASDRSSCRDSGTGDSARRSNDDLAHEDYKLIINEEPQPGWNVMRIASLTYI
PADPNSSHAPLLPGTPYVRSTNHDRPETPDKGAPPAEQSETTD
Download sequence
Identical sequences D6W6K8
TC001607 XP_971774.3.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]