SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC001980 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC001980
Domain Number 1 Region: 10-45
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000101
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC001980
Sequence length 102
Comment GLEAN_01980
Sequence
MGDYPKLPSYAVACSIRQFACANKKCIPISYVCDGDDDCEDGSDEGVKECPRFAQSLQES
IILITYSLSEHNFRYHISVKFLLTVFASVQSEILEQRIFEED
Download sequence
Identical sequences TC001980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]