SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC002002 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC002002
Domain Number 1 Region: 182-278
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000232
Family Fibronectin type III 0.0042
Further Details:      
 
Weak hits

Sequence:  TC002002
Domain Number - Region: 69-147
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0118
Family Formin homology 2 domain (FH2 domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC002002
Sequence length 288
Comment GLEAN_02002
Sequence
MADSVCLRTTSLYGDQFSHFEILAEEVAFDGIPDVFPKEENTEQDPLEIIGQEEASTSET
FDKNKTLLSLSKFLKTKNNSKKVTIEDLQQFCKEKKCKVIVCKNDTRELSAQLKMQQQII
ETMDKKIEQISKKVDQLEQQQNTTQGPFRLDISRTFDSPTSEACTILLPSRKPEPANQLI
KPPTRPILSARKVGKDVVLKWRMPYCSSKVYAPVASYEVYCYILNGSKRWRRMSKVESSE
LSMTFTLKNIDDDLIYYFGVRAIDVYKRRGLFSTEVTINNSKISSGCS
Download sequence
Identical sequences TC002002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]