SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC002514 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  TC002514
Domain Number - Region: 41-92
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 0.0053
Family Glutamine synthetase catalytic domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC002514
Sequence length 98
Comment GLEAN_02514
Sequence
MTVRCEKLLFSSVCYFVIRHCREILYEILRWCRSYELRFFHNWYLTRRLIIGSYLKLVEN
FLSVVVIYMCYDNRTLFLRLLFQTRNDEKSYYHSRKGN
Download sequence
Identical sequences D6WH68
TC002514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]