SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC002600 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC002600
Domain Number 1 Region: 112-369
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.46e-104
Family Guanido kinase catalytic domain 0.00000000272
Further Details:      
 
Domain Number 2 Region: 35-115
Classification Level Classification E-value
Superfamily Guanido kinase N-terminal domain 8.5e-34
Family Guanido kinase N-terminal domain 0.0000583
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC002600
Sequence length 371
Comment GLEAN_02600
Sequence
MAKAKCHNCETKCGKGKINPEVLTKLEDGFRRLATSNSQSLLKKYLTQAVFDKLKSKKTG
FGSTLLDCIQSGLENPDSNIGVYAPDPEAYTVFAELFDPIINEYHGGFKKTDQHPASTWG
DLKSIGDVDPDQKYVVSTRIRCGRSLAGYPFNPCLTEAQYKEMEKKVSGTLMSLTGELKG
KYYPLTGMSKRDQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIFHNTKKTFLVWLNEE
DHLRIISMQKGGNVGEVYQRLVCAVEEIETKLKFSRSDRFGYLTFCPTNLGTTIRASVHI
QVPKLAKDKAKLEAVANQFNLQVRGTRGEHSEAEEGVYDISNRRRLGLTEYDAVKEMHDG
ILKIIEMESCM
Download sequence
Identical sequences D6WFH2
7070.XP_967811 TC002600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]