SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC002601 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC002601
Domain Number 1 Region: 116-367
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.08e-75
Family Glutamine synthetase catalytic domain 0.0014
Further Details:      
 
Domain Number 2 Region: 29-115
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 1.7e-18
Family Glutamine synthetase, N-terminal domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC002601
Sequence length 369
Comment GLEAN_02601
Sequence
MPNTTLENSPNAVLNKSVAERYMHLPCPENKVKATYIWIDGTGENVRAKTRTVDFVPKKP
EELPVWNYDGSSTYQAEGTNSDTYLCPVAIYNDPFNGGNHKLVMCDTYKYNKKPTETNHR
HTCLQAMEAAKDTKPWFGIEQEYTLLDMDMRPLGWPKNGFPGPQGPYYCGVGANKVYARD
IVESHYSACLYAGINIAGTNAEVMPAQWEYQVGPCEGISIGDELWVSRYILHRVAEDFGV
IVTFDPKPIEGDWNGAGAHTNFSTKAMREDGGIIEIEKAIDKLSRNHLRHIQAYDPKGGK
DNERRLTGRHETSSIHDFSAGVANRGASIRIPRGCAEDKKGYLEDRRPSSNCDPYAVCEA
LVRTCILDE
Download sequence
Identical sequences D6WFH1
7070.XP_967731 TC002601 XP_008191348.1.52716 XP_008191349.1.52716 XP_967731.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]