SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC002661 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC002661
Domain Number 1 Region: 3-115
Classification Level Classification E-value
Superfamily L domain-like 1.28e-20
Family Ngr ectodomain-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC002661
Sequence length 151
Comment GLEAN_02661
Sequence
MKWLQVLVLENCRIQQIDPNVLEPLNNLKRLEITHNRGLTYLPQNLFKYTPVLEILLLVA
NRITNITWNEFEGLNRLKELSLAANRIDYFDATKVARFMPNLKKLFIEQNMGSCRKKLDF
KDKLQAKMDHPIHVQYTLDPGSYDDCKHFDD
Download sequence
Identical sequences D6WEP6
TC002661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]