SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC002791 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC002791
Domain Number 1 Region: 1208-1322
Classification Level Classification E-value
Superfamily ARID-like 6.02e-26
Family ARID domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1450-1621
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.000000934
Family TehB-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC002791
Sequence length 1764
Comment GLEAN_02791
Sequence
MVINRGEMKRKRRDECSSPLLDESPKRTKVHAQRKFAQGSNVNSPVITPVKEIEKQEVDV
LPEPVELLPIKRPNTEDFLTFLCFRGTPILPPSLNFFNTASIVDTNGQVHEIKSESPKNG
PIDTSTIAKAGSGSSDRPFIAFGVRKRADPIVISRQMDKKRRHALAVQALRRKYQEQRMA
KIRAVTISKLSEKVASKTLVRSNSVSKTEAVKKNATVQKSKVSVEPKQVKVATRSVKTAL
RPQIKQKMCLRSFRGRFVQKELQFRNVKKRPLPPVKKPVKKSEETSEYSSDDDKPLKTSK
SVVPKVAKKSAPGPKKPIEIKITRSNKFLNNKIVSRRQQIKQRMLLSTPKTTVKPRTLRS
QTAQKSKIETAKKVLIKSKEVGKKETVVKKLIETKTKELKVEALKKSDRLKKDVSPKMEK
PPPNVKKDVDSGKKTKIVPKPTPKKDETSSEKKDLVKKKAVMKKTAQKPAESPPRKDPPS
KKVDEDKKIDKPTEQMESRASQRPTRKTKEAAAIYMEILSHKLVNESRLDDDNVSIDSFP
ELPNVKKTEQRENELKAKAKTTKTSESESDTKKSPKKEMEVESKVLRSGSDKKKSEEKVK
KSEDKVKKSEEPVCDRKTRSAVASPLELKVHINAIEVTSEKKKEKKGKEKFEDDESSNSD
VSDNNLKTKDKSGKSDEGTKRQTRNSSQNIRHLEDTDDSDESFRADIRIPRKKQITRSKV
SKNCDSENDKNSLKKSLRTNSRSYRECSSSESDQSTTSDIKPTIVNKTKKFTKTRSVQKG
EQSFSDSDEEPLSKLTQNKLSDGKDVAIKEEPKESGEKETKPKRECAKRPQNYLPMFSSS
DEDENYFQGFKTKPEKPKITTKLPSPGCSHANTTVDLKDISRRFGKEKVNMSTEQIEKWL
KDSAMAGSSVKNENDAMLKFGEKIPTETSHSVANSIDTEKLKSLLITNIEKKEVSPKGLP
NEIKAILAKPMITDRKLIFRNKDRVGTVVGVSPNVNAFSVSNESSVYAFGEEEDVMKTPF
RRPTRRPSSTATSRSEDESSKFEEFAKFRKPTLVKQESEDNLPLGGTEDSPFFTPQRVTK
PKIDKKPMVPPKPPLKQTPKSCNSDASEEFKYKVPSSPSASSSSSAKLYKRQCTKPKIRA
SEVVPVKLPDFPVNGAQLVEGPTFHPSEKEFQDPLEYIEKIRPKAEQFGICRIVPPSTFK
PECKVTDDMRFTAYNQYVHKMLHRWGPNFKELMAIKKYLSTQNINLTHPPWIGGMEIDLP
RLYQTVQSLGGLKEVIEKKKWPKVSDLMKIPKSAQDRVTKLDDIYCKYLLPYDTLSPAER
EKLFDEVETEWAKRESKSLLKAQQNIDDNNTEIESESDDEAEECIVKGRSMALNAFYRIA
RNTMSMWFRTCEPPAEEVEQEFWKHVTVKQNHICVHSGSIDSGNWGYGFAVSKNSPFARH
AWNLKVLTNNSGSVLRSMGPVMGVTVPTLHVGMVFSSCCWYRDPHSLPWIEYLHTGGNKI
WYGIPDSTSGAFHTALKTLVPNYCRNKSLWLPSDTVMVPPNLLVENGVSLSRIVQEPGQF
IIVFPKAFTSSLSTGYVVSESVYFAPSYWLKTGRLVFNELRNSCEPSMFSFDRLLLSIVN
DARSNVEVLKQIIPAVQELCDKEKSARERVRKLGVSATEKLPLPDAPKKKKKLHNEDGEY
ECEICRMNLFVSMVIESQEDLVYCLDHAAEQIEQKKIQCKNCTLSFTYDDTELDGLVDKI
KSAICNKLQKKVPNRFTGMPTLLK
Download sequence
Identical sequences TC002791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]