SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC002888 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC002888
Domain Number 1 Region: 6-331
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 7.69e-61
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.00000000709
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC002888
Sequence length 334
Comment GLEAN_02888
Sequence
MDGDKKPWDPSQLRKYDLNLEEIPRLHYKDPKIDEYIKENKPVVITESNIVKPAVQRWSL
EYLERNLGHSGHTVFVSRNHKFKYYDEKKIYNRVSNTKGVEFTPPTRKVEMRIEDFMKRV
KEWKKGDERIYLQQSLTTTVGNNIVEDFVKFDWDYVNGKQTKHNWGPLTSNLLFIAMEGN
QTPCHYDEQENFFAQVQGYKRCILFPPSQFECLYPYPVHHPHDRQSMVDFERPDYNKFPK
FKNVKGWEAVVGPGDVLYIPIYWWHHIESLLRGGPTVTVNFWYKGGPSTLEYPLKDHQKV
SITRNVEKMLLEVLQDPKEVGPLLRSMVLGRYTE
Download sequence
Identical sequences D6WHQ8
TC002888 XP_975469.1.52716 7070.XP_975469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]