SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC003519 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC003519
Domain Number 1 Region: 112-311
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.51e-24
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.054
Further Details:      
 
Weak hits

Sequence:  TC003519
Domain Number - Region: 41-105
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0557
Family C-type lectin domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC003519
Sequence length 319
Comment GLEAN_03519
Sequence
MNNNKHDTNVEEIKHIFLGLNREFVKSGLSTKELENACLPQCSKHTNSVLFIVFLLLALL
LATSYQYGLFTSAISYFLGVRCLVPNNYFIWEATRPVSNCNFCKNVHKPLILNNVTREEF
APYAYSSKPIVIKQAFLHWPAMKYFDFNFFKELYNSISDSYKSVDEECQFLHFKSNFISI
RDVFEMSEARVQNKPGEKSWYVGWGNCHPQILAEMRKYYPKPHFLPEDCEIPSKEYVFMG
YDDGATMHLDFINRLMWQAQLKGSKTWHLVPPPECEDVCSQFSFLVEPGDAVLVDTRVWY
HGTQITPGQFSLSVQSEYG
Download sequence
Identical sequences D6WHD1
TC003519 7070.XP_975139 XP_975139.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]