SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC003789 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC003789
Domain Number 1 Region: 146-224
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000654
Family F-box domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC003789
Sequence length 295
Comment GLEAN_03789
Sequence
MAVSGVFKKNKVAQKNLLRTIAGFNELNEAVKKLDFMSAVRDVRRFNYICALLGLLIGQQ
MTALSGCAQKVLLAMLEEVASQAVASQHNPRNFRQLLKNLRSLSEAERSSCWGGLLGSQV
LWSEHTAKIERILKMAANMQICELSPESRPQLLQLPEECIREIILRLSDHRDLTASAQTC
EQMATIVGEQRVWRELTKFHFTPHQIELVLPKNGEKVDWKDVYHSLKKSFGLSEDRQYAE
MLSLCRYCRCLFWRSSGHPCIADQCPEFRARLQEAGGITPPSPVPPSAFLKFFSL
Download sequence
Identical sequences TC003789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]