SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC003939 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC003939
Domain Number 1 Region: 62-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000115
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC003939
Sequence length 122
Comment GLEAN_03939
Sequence
MLIRVIVVFVLGLELCTACDMDQTKQGCRIQNKACSCGFGCISEYRYDTMAECQNALRGK
RRDICNPNPCLHGGSCIQISQRPKYKCRCEGTGYFGLRCSRACPTPGVGPTDAVFPYECI
EI
Download sequence
Identical sequences D6WHZ0
XP_008196865.1.52716 TC003939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]