SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC003986 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC003986
Domain Number 1 Region: 968-1246
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.47e-76
Family Protein kinases, catalytic subunit 0.00000000863
Further Details:      
 
Domain Number 2 Region: 455-643
Classification Level Classification E-value
Superfamily L domain-like 2.27e-39
Family L domain 0.00021
Further Details:      
 
Domain Number 3 Region: 175-337
Classification Level Classification E-value
Superfamily L domain-like 1.28e-37
Family L domain 0.00021
Further Details:      
 
Domain Number 4 Region: 626-786
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.36e-17
Family Growth factor receptor domain 0.00013
Further Details:      
 
Domain Number 5 Region: 314-460
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.2e-17
Family Growth factor receptor domain 0.00000488
Further Details:      
 
Domain Number 6 Region: 746-872
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000157
Family Growth factor receptor domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC003986
Sequence length 1475
Comment GLEAN_03986
Sequence
MGIRHLLVLFVVVLLVLVVCDCRQHYNRNRRRGGAKDKALALHHQENEFHNKGKTQLSLP
GVRPVPYSRPGKFSEKKGQQRATSTDNNNKPIIAQQPVLLRHLPAVICINGYRFCNGTVS
RDPGNGLRPKDLIANVNTVYLLCIFVVNRLIPIFLPVCIGTNGRMSVPSNREHHYRNLKD
RYTNCTYVDGNLELTWLQDENLDLSFLQYIREVTGYVLISHVDIKRIVLPRLQIIRGRTL
FKMNVRNEEFALLVILSKMYTLELPALRDVLIGNVGVFNNYNLCHFKTINWKEIITDPKS
KYVFVYNFTSPERDCPPCHKNCEKGCWGEGEENCQKFSKENCSPQCYQGRCFGPNPRECC
HLFCAGGCTGPKQSDCIACRNFYDDGVCTQECPPMKIYSPITYSWQDNPNGKYAYGATCV
KNCPEHLLKDNGACVRSCPPDKKAHEGACVPCNGPCPKTCRVDTFIHSGNIDTFKGCTVI
EGNILILQNTFEGYQHFYPNYTFGARYPRMHPDRLEVFSTLKEVTGHINVQAYHSDFTNL
SYFRNLEVIGGRSLSDYFTSLYIVKSSLKSLELRSLKRLNAGTVAILENTHLCFADNINW
DKIRRSHEHVVMISNNSDPRLCKGNNLVCDSECSRDGCWGAGPDQCLSCAHFQLENESRC
IANCSVLPGIYQDGPNICKRCHEECGSSCTGPGADKCVTCKRFQDGPYCVPSCPTNKYHE
NGGCNSCDRAIMNETDSMVYCLGSNESCPDGYFNEYLGPQEKESLKSLAGSALCRKCHPR
CKICSGFGFHELVCQKCTHYKKDEQCEDECRSGDYADEEVQECKPCDPECKGCTGPGPEN
CISCENFKVFDDGYVSENSSFRCVSSCPPEFPHRVFPDNAFSYCSDKPLNLPISGFVDNN
YTVVIATGITSAIIIIIIIIILVTWFFRKKVKAEESTLKMTMALTGLEDNEPLRQTNVSP
NCKKLRTIKETEIRRGDILGYGAFGTVYKGVWILEDENNSKIPVAIKVLRDGSTSSKEFL
SEAFIMASVEHPNLLQLLGVCMTSEIMLITQLMPLGCLLDFVRKNRDRIGAKALLNWSTQ
IAKGMAYLEEKRLVHRDLAARNVLVQTHSCVKITDFGLAKLLDVDEDEYKAAGGKMPIKW
LALECIQHRIFTHKSDVWAFGVTIWELLTFGERPYDNVPARDVPELLEKGERLPQPEGCS
IDVYMILVKCWILDAESRPSFKELAEDFTKMARDPCRYLAITADRFARNRNNAQDDRKLV
HTLASTLETSASQSECDEYLQPKSRAPLRPVGWMSSVSPSPTPDKYWKSASQTNSDGSCN
PQYQNHLNRKLLKYPPSTASDTLKMRDDMSSDEYDSGPSKAQLGSLKLDLPVDEDDYLMP
SPQQTQGASAYVDLIDSKNSDTSNQSVFRSLDFYKSNIDNPEYLMNNEAAPSQTVGLPQV
PRSSEEESDHEYYNDFDRLKRELQPLQRNKDGAIV
Download sequence
Identical sequences TC003986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]