SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC004042 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC004042
Domain Number 1 Region: 317-437
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000353
Family YWTD domain 0.00079
Further Details:      
 
Domain Number 2 Region: 111-145
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000798
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 147-187
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000565
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 63-101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 24-60
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 263-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000184
Family EGF-type module 0.006
Further Details:      
 
Domain Number 7 Region: 198-230
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000537
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number 8 Region: 234-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000838
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC004042
Sequence length 441
Comment GLEAN_04042
Sequence
MYKLLVLVGALASAYGFLLSSKASNCTDNDFFCQNFECVPSKMQCDGNPDCSDGSDEHDC
DMFHCASPDFFRCKNSRCISSAFVCDLENDCDDFSDEENCEEFKKKLEKNSTCTRDQWQC
TDKLCIPLEWVCNGEPDCLDGSDEALGCSHTMECNDGFKCKNGHCIFKEWRCDGQDDCRD
NSDEEDCESHFELKECTLENQRFLCSDTKTCIKLSEVCDEVNHCPDKSDEGFSCKKTCEN
CSHNCVQLPTGPKCLCPKGYRNIDEKHCQDINECEIYGICDQKCKNTPGSFECYCEDNYN
LQEDKKSCKAHFGEALMFFSSKDQIRAYLLRSELYFPVAKNLNQVVGVDFDGLYVYWTDI
LSEHESIVRSLKDGEQKELLVTAGLGAPEDLHVDYITRNIYFTDAERQHIGVCTNDGSYC
TVLVTKDVQKPRAIVLNSLEG
Download sequence
Identical sequences 7070.XP_970553 TC004042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]