SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC004438 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC004438
Domain Number 1 Region: 826-974
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.66e-43
Family Toll/Interleukin receptor TIR domain 0.00014
Further Details:      
 
Domain Number 2 Region: 114-342
Classification Level Classification E-value
Superfamily L domain-like 5.83e-41
Family Ngr ectodomain-like 0.025
Further Details:      
 
Domain Number 3 Region: 283-567
Classification Level Classification E-value
Superfamily L domain-like 2.04e-39
Family Ngr ectodomain-like 0.042
Further Details:      
 
Domain Number 4 Region: 629-766
Classification Level Classification E-value
Superfamily L domain-like 1.87e-16
Family Ngr ectodomain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC004438
Sequence length 1046
Comment GLEAN_04438
Sequence
MKNVWLVLLLLIYFKPSTSLKCNRDDKKCLCLPGAEFEFQCPSSFENGDTGDYPDYVIHI
KEDKDILIDCSPNLKQFNITSLPNVTIERTESFRMRFCPLPPRNFKEVLDWFGIKQVKYL
QYSHYELANTTLTKDYFEGLEDLEKLSLENNGLVDVEEDVFANTPKLTSLDLQVNKIKLG
ANLFNNTPLLKSLDISQNNLDYLPPDLFKKLEDLELLHVWDNKIRFIDDSTFQGLTNVKS
IELSGNLIETITENAFKNLSNLERVNLSMNKLQYVPGDLFRHNQKLKLVLLKMNEGLYLP
GYLFSNMSQLEEVDLTDCKLKGISSDIFKHSLNLKRIKLAHNTLDFIPQTLFEGLTNLEE
IYLNNNNIETIDQIFKTLRQLKILTLEGNRIRDVGKAAFDDLIRLEKIILRHNQITKIDN
RAFYNNGNLKTIDLAHNQITGNYSSKLVLLENVHDAETIDLSHNLITRVDDIVTMYNKNK
LKSLDLSYNRIEVIGLQELQPFTKKVIIKLDHNHIKTVDFSYVEVVATSGDAKDALSDPD
PWHSVIDLNENPLNCDCHNFDLVRYVTNELRPEIKVMFDLKMDNLKCANPPPLEDFPVES
LVPKLLICPVEDGCPERCLCSQRPFDRTIIINCADKNLTQYPQLNLSDFTNIDFVQTEVH
LEGNSLNTGPGKNLTGYGNVTELSLSSNKIETISWVPPNIKVLKLDNNKISYLNWEVLHT
LNESNLHSLTLHNNPWTCDCQAANLTNFLRQNPKILDAKHVYCFNSTNRLIELNRTDLCH
EWQVVYLVLIVLSVLFFVALAFALYYRYQQELKVWLFAHNLCLWWVTEEELDKDKIYDAF
ISYSHKDEDFVTQNLLPVLEGGPQPYKLCLHYRNWIPGEFITTQVTNSVLESRRTLVVLS
PNFLESVWGKMEFRTAHTQAMTEGRARVIIVLYGDVDVDSLDDELKTYLKTNTYVKWGDP
YFWNKLKYALPHTKRNVANQQKMANVMNCIDDKFKLVVPVTNSPGSTPPVLALDANMLKH
PLNFVPSQEMDTPPAEAGTLLVSTGL
Download sequence
Identical sequences D6WCW7
TC004438 7070.XP_967796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]