SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC004452 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC004452
Domain Number 1 Region: 84-456
Classification Level Classification E-value
Superfamily L domain-like 4.17e-61
Family Internalin LRR domain 0.029
Further Details:      
 
Domain Number 2 Region: 740-884
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.27e-39
Family Toll/Interleukin receptor TIR domain 0.00017
Further Details:      
 
Domain Number 3 Region: 549-679
Classification Level Classification E-value
Superfamily L domain-like 4.42e-17
Family Ngr ectodomain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC004452
Sequence length 903
Comment GLEAN_04452
Sequence
MRQILWLITFCTILKFAFCEIICNDPKGSCGCLGRRVLCSTAKTDDIIIDISKGIIDMEC
PRELKQLHFEKPPNVTIDSDISKFTMRYCPLPPNNFREIFAWFSLQNVETFEFYASELNA
CTLTNKYFQSLENLKQLILSDNAIDDLDENFFTNMPQVKLLDLKNNRIKLTKSTFKNLQF
LQHLDLSSNNIKFVPHGAFQELETLTTLNLFDNQLTKIDDFTFAGLSNLQSLELSANKIQ
TISENAFATLKNLTRINLSNNFLKTLPGGLFQGNRNLKTLRLKHNIGLQLPGLVFANLFL
TEVDLTKCRLGEIPENVFENTTTLKVVELGGNDLEDLPENVFKGLTNLGKISLQHNKIKS
ISHLFKGLERITLLQLQKNSIEKIESEAFADLINLEKINLRGNRIKQINPLVFSRNHKLK
TVVLADNEIVDKFEEAITSTQTNNLIRWNLRHNRIQQIKLANWKNVSITLDYNPLICNCL
NYNLLNHIRNQTRSNNLTITAKNVKCEGSQVFENLELSSLTCSLDEISKNYLCPKNCSCI
WRPFDASVVINCSNKSLVKYPQVDLSQLTYVYNDIELHLENNKLESGPERRFGFLNITKL
FLSNNTIRSIDWVPPRLKSLHLDKNRISKIPPKVIEVLKQTTLVNLTLNDNPWMCDCGAE
ILAQFLRTFPNFSTNIYCANTTLRLIDMKKEDFCKSQTVLYLTTLTLSLLLISALLAIFY
YRNQETINFWLLSHNLCWFSEENRDKDKIYDVFISYSHKDEHFVEALLSFLEKGPNSFKT
CVHYRDWTPGEPIVSQIINSVVNSRRTLVVLSRNFLESVWGKMEFKTAHRQALSDGRNRV
VVVWYGDVEVEKLDEELKVYLRTNTFVKWGDKFFWEKLKIALRRTVKWGSKMGVQEEEDM
LIV
Download sequence
Identical sequences D6WCU4
TC004452 7070.XP_973926 XP_015838161.1.52716 XP_973926.2.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]