SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC004474 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC004474
Domain Number 1 Region: 365-684
Classification Level Classification E-value
Superfamily L domain-like 8.5e-48
Family Internalin LRR domain 0.022
Further Details:      
 
Domain Number 2 Region: 105-462
Classification Level Classification E-value
Superfamily RNI-like 2.28e-47
Family 28-residue LRR 0.038
Further Details:      
 
Domain Number 3 Region: 762-957
Classification Level Classification E-value
Superfamily L domain-like 2.04e-32
Family Ngr ectodomain-like 0.0096
Further Details:      
 
Domain Number 4 Region: 1032-1171
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.83e-28
Family Toll/Interleukin receptor TIR domain 0.00028
Further Details:      
 
Weak hits

Sequence:  TC004474
Domain Number - Region: 41-123
Classification Level Classification E-value
Superfamily L domain-like 0.000748
Family Ngr ectodomain-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC004474
Sequence length 1310
Comment GLEAN_04474
Sequence
MWLELVLNLVFLATCLSATRYDGPEGCSWLPDNNDTSSSKFSVTCRVRTLDGTGTNISAL
PAEITSKLRLLCSEVLFFESALPTQGLQRLHELEELQITNCKLLNIEANSFEGLYNVKRL
AINTFNSDWSSSKTLDINADSLKGLKELQILDLANNNIRAVVDGTFCSLANLQTLNLTRN
RIKSPERFGFNLPECSNSELQNLDLSHNELRALTENSGFSRLRRLQQLDLKNNNISDISG
EALAGLVSLRILNLANNKIESLPEGLFAGSRELREIHLQNNSLFSLAKGLFHRLEQLLIL
DLSGNQLTSNHVDAGTFAGLIRLIVLNLSHNALTRIDSKTFKDLYFLQILDLRNNSIGFI
EDNAFIPLYNLHTLNLAENRLNTIGPLLFNGLFVLSKLTLNNNLVVNIDSTAFRNCSALK
ELDLSSNALQEVPDALKELSFLKTLDLGENQISDFRNGSFKNLNQLTGLRLIDNNIGNLT
RGMLWDLPSLQVLNLAKNKIQSIERGTFDRNTQLEAIRLDENFLTDINGVFATLASLLWL
NLSDNHLVWFDYAFIPSNLKWLDIHRNFIEHLGNYYKIQDEIRVKTLDASHNRITEISPM
SIPNSVELLFINNNFIKVVKPNTFLDKTSLARVDMYANELVNLDMNALRLSPVPPNRSLP
EIYLGGNPFHCDCTMEWLHPVNNMSASRQYPRVMDLDNVMCKMTHSRGMAHMPLTRAKTS
DFLCTYETHCFALCHCCDFDACDCEMTCPNNCSCYHDQTWNTNVVDCSGQNAIEIPHRIP
MDATEVYLDGNDFRELQNHVFIGRKNMRVLFVNNSGIETIQNSTFNGLHTLQTLHLEDNK
IYALEGYEFEHLSNLKELYLQNNVISSIGNKTLEPLKSLEILRLDGNKLVVFPVWQLSSN
SHLTEISLANNRWSCRCKFLQEFTAWVADNAPKVVDSASIQCYNGEATPQRRDLDFNSTA
CSDFYAGSSVIDSMLVSDYWKMVVVTLCIVILLLLGVVLWFVFRDPVRVWLYSRYGIRLC
SFRAAAAKQYEDRDKLYDAFVCYSPKDEEWVVQALAAELESNFQLCLHYRDLPHAAYLQH
AAPAVLEAAEASRRVLIILTRNFLQTEWSRFELRQALHEALKGRVFKLVILEEGPLPEAE
LDPELRPYLKTGNRVRWGEKRFWEKLRYAMPSGEPRGKINANYRRNINNYTIDSRVVANG
THSHTYPEKIKTQGPPSPGMQMFPPPAYSAGAPHEPDDANYSSATTATPSPRPMRRAQEP
RPISDHIYSSIDSDYSTLERGGSGRRGPPWRPHVMMQTAGVNNGGQAYLV
Download sequence
Identical sequences D6WCJ1
TC004474 XP_972409.1.52716 7070.XP_972409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]