SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC004523 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC004523
Domain Number 1 Region: 367-637
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.06e-57
Family Eukaryotic proteases 0.0011
Further Details:      
 
Domain Number 2 Region: 72-110
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 221-285
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000389
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 4 Region: 121-160
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000089
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 34-70
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000615
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 158-199
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.002
Further Details:      
 
Weak hits

Sequence:  TC004523
Domain Number - Region: 298-356
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00139
Family Complement control module/SCR domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC004523
Sequence length 653
Comment GLEAN_04523
Sequence
MCNATLIQVICLFLAIQIVPSFSFHQSNITRREAKECPRNSFACKSGECIDEDKECDGGV
DCKDASDESNACARIKCPISAFRCDYGACISADLECDGKPDCRDGSDEKTPNCQIIDETS
PICKSNEFRCSSGECIDEDNKCDGIAQCSDRSDEIRATCWNLRCPIYSYKCKYGACVSGN
AECNGKIECQDGSDEDPNICKNSTVLTPTPSPVVPRPGARGRCVLPNHPEFGKWSIFGPE
NLSPGATVNPGTILNIVCQNGYKLEGNSVIYCANGQWTENIGVCLKLCSPLSSTKVMTVT
CTYPNNKGEGNCTNAIDGTLARFKCEPLYEDPNLQRIPGRVCRDGTWDNSSPECVPGQVP
IVIYLHVNLNINLEICGQKSVEVQKLIVNGKTAKRGTYPWQAALYTRDKKELICGGSLIK
LNMIITAAHCVTDQQERAQPLPKENYIVALGKYYRKFDDPRDSKEAQFSELKKIIVNEKY
SGPIQNFGSDIALLITSTVFVPSLRVQPVCMDWNLQFKIGDDQVFGYVTGWGYTVEGSNP
SEELKELKVPLIPESKCRKDLPVDYDRYYTYDKLCAGYLNSNTSVCRGDSGGGLVVKRNG
DRFYLTGIVSLSPTSPREIDGCDSQQYGLYTKVAAHTEDFILKKVTEYGINAR
Download sequence
Identical sequences TC004523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]