SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC004535-GA from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC004535-GA
Domain Number 1 Region: 342-625
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.16e-58
Family Eukaryotic proteases 0.00097
Further Details:      
 
Domain Number 2 Region: 222-286
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000445
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 3 Region: 72-110
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 121-160
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 158-199
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 6 Region: 35-71
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0011
Further Details:      
 
Weak hits

Sequence:  TC004535-GA
Domain Number - Region: 301-360
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000542
Family Complement control module/SCR domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC004535-GA
Sequence length 636
Comment GLEAN_04535
Sequence
MCSATLIQVIRLFLAIQIVHSFSFYQSNITKREVEECPSNTFACKSGECIDEDMQCDGGV
DCKDASDESNACARINCPIFAFRCDYGACIFPNLECDGKPDCRDGSDEKTPKCQIIDETS
PICRSNEFRCSSGECIDEDNKCDGIAQCSDRSDEIRATCWNLRCPSYSFKCKYGACVSGN
AECNGKIECPDGSDEDPNICKNSTVVVTPTPPPVVTRPGARGRCVLPNHPEFGKWKIFGP
DNLSPGATVNPGTILNIVCQNGYKLEGNSVIYCANGQWTENIGVCLKLCSPLSSTKVMTV
TCTYPNNKGEGNCTNAIDGTLARFKCEPLYEDPNLQRIPGRVCRDGTWDNSSPECVPVCG
QKSVEVQKLIVNGKTAKRGTYPWQAALYTRDKKELICGGSLIKLNMIITAAHCVTDQQDR
AQPLPKENYIVALGKYYRKFDDPRDSKEAQFSELKKIIVNEKYGGPIQNFGSDIALLITS
TVFVPSLRVQPVCMDWNLECKIGEDQVYGYVTGWGYTVEGSNPSEELKELKVPLIPESKC
QKDLPLDYIRYYTYDKLCAGYLNSNTSVCRGDSGGGLVVKRNGDRFYLTGIVSLSPTSPR
DIDGCDSQQYGLYTKVACHTQDFILKKVTEYGINAR
Download sequence
Identical sequences D6WAZ7
7070.XP_970945 TC004535 TC004535-GA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]