SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC004644 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC004644
Domain Number 1 Region: 154-208
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000802
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 2 Region: 62-167
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000146
Family V set domains (antibody variable domain-like) 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC004644
Sequence length 250
Comment GLEAN_04644
Sequence
MATCEHLGVSYEGLDCRSHLQVENRCRNTDSFTQKIRGARAGGGEAWIFAFEKRIFDVTN
LPVQSIIIKAGENKSLACPGVNEHSLVIALEWLSLTHNVKLVEFMSDSTTVWVNQHRIAL
LPDTFGLSFHPAIAEDSGDYVCLVNSRPKPDGIVRLIVQDVPDAPGRPLIVSFTSRSVNL
SWAPSQDTHHSPITHYIIHTRSGASPIRQKRTLKVIRQNQRYEPYTFVFFSLIFKILYFT
RYDELKHTEH
Download sequence
Identical sequences TC004644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]