SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC004901 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC004901
Domain Number 1 Region: 216-470
Classification Level Classification E-value
Superfamily L domain-like 6.8e-53
Family Ngr ectodomain-like 0.015
Further Details:      
 
Domain Number 2 Region: 384-704
Classification Level Classification E-value
Superfamily L domain-like 1.11e-48
Family Internalin LRR domain 0.07
Further Details:      
 
Domain Number 3 Region: 1047-1197
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.1e-27
Family Toll/Interleukin receptor TIR domain 0.0016
Further Details:      
 
Domain Number 4 Region: 771-940
Classification Level Classification E-value
Superfamily L domain-like 1.47e-26
Family Ngr ectodomain-like 0.0051
Further Details:      
 
Domain Number 5 Region: 102-202
Classification Level Classification E-value
Superfamily L domain-like 8.5e-16
Family Internalin LRR domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC004901
Sequence length 1321
Comment GLEAN_04901
Sequence
MYSTTVLLVLIGVGIVKSRSLTSIETIPRGCDWQMQPVENEAREEPVLSCRIRTINSAGP
LLGNLSQTQIDRVAVLRLECSDMLFFESSLEAGSKHGSFLTGLRWLKELKLEFCKMRNIP
AGVLKPLRQLRAFSLRSHNSDWSSMTLELHPESFLGLSELRSLDLGDNNIWSTPPDLFCP
LFSLTHLNLTMNKLQNLSALGFSDWGNGPLAPGRACVSGLEILDLSHNDIIALPDNGLSG
LRSLEELHLQDNAVSTLGDRAFVGLTSLHTLNLSSNCLVALPPELFQSSRDLKHLYLHNN
SLSVLAPGLLEGLDQLTVLDLSRNELSSHWVNRDTFAGLVRLVVLNLAHNQLTRIDANLF
HDLYTLQILNLENNQIEFIADGAFSELKNLHALTLTHNFITRIEAYHFSGMYALNQLLLD
SNKIEYIHPQTFENVTNLQDLGLNGNMLGGVPVGIGKLRFLKTLDLGKNHIEIVNNSSFE
GLDSLYGLRLVDNHIVNISRDAFSTLPSLQVLNLASNKIKYVEQSAFASNPTLKAIRLDA
NELSDISGVFTNLQSLVWLNVSSNKLLWFDFSHLPSSLEWLDMHDNKITELGNYYDVKNT
LKIKMLDASFNLLTDVHDNCIPDSVETLFLNNNKITNVHPNTFVKKIHLQKVVLYGNDIK
YLDIAALSLSTVSDDKDLPQFYIGGNPFYCDCKMEWLLRINHLSNLRQYPQVLDLDTVTC
ELAHARGSPPQPLLSLKPSQFLCPYKSHCFALCHCCEFDACDCEMTCPTNCTCFHDHTWS
SNVVDCSNAGYTNVPEKIPMDATEIYLDGNNLGELGSHVFIGKKKLEVLFLNNSNVNAVH
NRTFNGVKSLKVLHMENNNLEELRGFEFDQLEKLNELYLDHNKIAFVSNQTFKNMHELEV
LKLDENKIVDFIPHWENVAPRVTLDGNKWSCDCNSLGRLEIWIRETGGDPSKLFCLDRDD
SETVADVITRCDNKDNAIATSVIQREVLKNNPLLGGSYVPLLAATLVAVIVFCLLAAVVF
VFRQDVRLWAHSKYGIRIFQDAATAHDNKDERDRLYDCYMVYSHKDEELAARIIAPELEQ
LGHTLCLHNRDLALHGGASYLADAMVGASDASRRVIFLVSPALICNEWSRPEFRAALQTA
LRTAHRHKLVCVLSGDPLEPMDPELRALLRACTVTRWGERRFWEKLRYAMPDVANSNRSR
RGKKHHQPEIRCKVSARYTAAPTAPDSWYKYSAMPGVHAALTPTPTQSTYVSGESARSTE
DEGSSASSQHYGSEQLNHSYVSIDGRPPPQYTQYPICRPEIAHHLYSTIPDTQPQSRTYF
V
Download sequence
Identical sequences D6WCH9
TC004901 XP_972312.1.52716 7070.XP_972312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]