SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC004931 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC004931
Domain Number 1 Region: 18-212
Classification Level Classification E-value
Superfamily L domain-like 2.04e-37
Family Internalin LRR domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC004931
Sequence length 238
Comment GLEAN_04931
Sequence
MGNSGLKQHIVTAQKTGVLKLSQGHLNGFPPEFRQLEGNLRTLDLSDNKFVNLPNEISRF
LQLKHLNLNKNKLVKIPDCIGALTKLETLNLCHNNLTSLPRTLSNLINLKQVYLCENHLK
EVPLMFCSLKHLDILDLSKNDITSVSAEVSGLNVVELNLNQNQISEISPQIANCPRLKTL
RLEENCLQLSAIHSKILTDSKICNLAVDGNLFELKQLADVPGYDAYMERFTAVKKKLF
Download sequence
Identical sequences D6WCS9
TC004931 7070.XP_973486 XP_973486.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]