SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC005085 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC005085
Domain Number 1 Region: 74-273
Classification Level Classification E-value
Superfamily L domain-like 3.23e-21
Family Ngr ectodomain-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC005085
Sequence length 330
Comment GLEAN_05085
Sequence
MLLFHFVVFCALSESNTDLECDDVSVTPLTFYEQREGSLKQTDTVITLNDTYGITIESNA
NTVLCNKMFNITSTIEILLFSAGNITQIETKFLENVDVTRYIILVNNNIKTIKKHTFNNL
PVANILLTYDSITVIENEAFMDLINLKMLDLNQNCITHFNPHAFVRLPSLFHFIISSNNI
SKLEKNCLSFIEQNNTFIDFSRNNIVSIDNEALNGAPFYINELDLFGNQLHDLSWRFLGN
HIIKKINVASNQINDISDEFLEESFGTEFLIIDLETLSNDSLIKVANFCMKKSNNPTDLI
VKLWSCWYESLLPLPSTNYLTDIKLATENE
Download sequence
Identical sequences D2CG03
7070.D2CG03 TC005085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]