SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC005131 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC005131
Domain Number 1 Region: 55-169
Classification Level Classification E-value
Superfamily L domain-like 7.48e-28
Family Ngr ectodomain-like 0.0047
Further Details:      
 
Domain Number 2 Region: 202-302
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000613
Family V set domains (antibody variable domain-like) 0.07
Further Details:      
 
Domain Number 3 Region: 278-378
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00000000115
Family Hormone receptor domain 0.0061
Further Details:      
 
Weak hits

Sequence:  TC005131
Domain Number - Region: 371-428
Classification Level Classification E-value
Superfamily DNA clamp 0.0424
Family DNA polymerase processivity factor 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC005131
Sequence length 525
Comment GLEAN_05131
Sequence
MEKPKLDTVGANDTLCPTKCVCKRVNQRDELKLRCGEPDNKILSFEEIDLLNIANDIVQF
DLSKNRLTELQDNQFAELPNLRRLDISGNNIKSIQLLAFAKLGSLERLKLNQNQISTIAL
GTFNPLVSLKQLDISNNPLTCDCSLLWLLDWSQKESVKLLSNPTCNTPPSFKNLPLRKLK
IGVDIHCKSKALSKGFPIIEMKPSVNQVVFEGDPLKLQCTAPSISDTYDSPLSSKIEWTW
LDSDPKLYFSDITIENHFLQSTGLVVSTLQIAKLKRNHTGIWTCLLLSMQGNHSKGITIV
VISDETEYCPITVTSNNKGTYTWPRTVVNYTATVPCESPNLSYDVSLHKASYFCSVEGQW
ENLNTSACSYTSETTKILEQFSKVNSSIVESAKHFKNYTSVAEHFKDEMDIVFAVETMEN
YLRYLTVNQIGGVLMDVTNNLLNLPKEYLRWADYRYGSCRKLVNISEKLAGISTTALLHK
KFRNHIWKIKRESLYLFSNVFKIENEFNKSKNFKVKFGQFQVPIT
Download sequence
Identical sequences TC005131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]