SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC005184 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC005184
Domain Number 1 Region: 809-857
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000201
Family Laminin-type module 0.0049
Further Details:      
 
Domain Number 2 Region: 855-907
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000711
Family Laminin-type module 0.0066
Further Details:      
 
Domain Number 3 Region: 1016-1064
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family Laminin-type module 0.0034
Further Details:      
 
Domain Number 4 Region: 351-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000162
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 5 Region: 761-802
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000173
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 6 Region: 271-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000858
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 7 Region: 504-544
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 8 Region: 1067-1109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000114
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 9 Region: 964-1007
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000017
Family Laminin-type module 0.0035
Further Details:      
 
Domain Number 10 Region: 915-966
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000527
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 11 Region: 453-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 12 Region: 393-450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000246
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 13 Region: 1223-1377
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000105
Family Tropomyosin 0.0052
Further Details:      
 
Domain Number 14 Region: 1115-1162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Laminin-type module 0.013
Further Details:      
 
Weak hits

Sequence:  TC005184
Domain Number - Region: 109-170
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00136
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.084
Further Details:      
 
Domain Number - Region: 1607-1751
Classification Level Classification E-value
Superfamily PhoU-like 0.00209
Family PhoU-like 0.016
Further Details:      
 
Domain Number - Region: 1574-1635
Classification Level Classification E-value
Superfamily Tropomyosin 0.00464
Family Tropomyosin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC005184
Sequence length 1755
Comment GLEAN_05184
Sequence
MVGEIKYRLGGVGFILIRKARYVPVKLHPCEQSSCYPATGNLLIGREHQLYASSTCGLHG
PQRYCIVSHLEERKKCFRCDSRPTNKPNPLFNHNISNIVYRMYPGTRQKSWWQSENGKEG
VYIQLDLEAEFHFTHLIITFKTFRPAAMLIERSYDFKQTWHVYRYFAYNCAESFPHIREG
YPVNLTDVVCESRYSSIDPSTDGEVIYRVLPPTLHIDNPYSEQVQNLLKMTNLRINFTKL
HTLGDDLLDKREDIQEKYYYAITDMVVRGSCSCYGHANRCLPLPGIEPKPDMVHGRCECT
HNTKGRNCEKCEDFFNDLPWRPAIGKQTNACKSRFETYCHFDAALYEATGRISGGVCDGC
QHNTMGPNCEQCKPFYYRDPQRDIQDPEVCRPCDCDPRGSLDNGICDSITDAENNLIAGS
CHCKTNVEGRRCDICKNGFWNFTESNPDGCQSCTCNTFGTIDNQGCNVYNGECTCKRYVT
GRDCNQCLPEYWGLSEKRDGCQPCDCDPGGSFDNNCDVITGQCLCREHMTGRTCSIPKQQ
HYTASLDFLLYEAESARASPNCQVVIREPPRDGSDVTWTGIGFMKAFEPSYIEFTVDNIK
TGMDYEIVIRYEPTMPTNWEEVEVTLERPGPVDPNGPCNGARDDPRRVALPSNSRSVTVY
PPVCLEPGRTYKIRLTFRRSNFERETPSASVLIDSVVLIPRIEKIPWFYGSVPAEARRQE
FERNRCSSYSSYLIHTGQIPEVCKKYYSSIGAYIFNGAFSCQCDPTGSLSKLCDEYGGHC
TCKLNVVGRRCDQCAPGTYGFGPEGCKSCDCNSIGALDNFCNATTGQCKCRANTYGRECD
QCRTGFWNFPNCQRCDCNGHADICDSKTGACINCKDNTEGHNCEQCVDGFYGDPRLNVDI
PCRPCPCPGSPWSNHSYADRCSLEASTKDVICECHVGYSGSRCDVCSDNYFGNPEEPGGL
CQPCDCNDKIDILKPGNCDPHTGKCKQCLYDTTGDHCEVCRPGFFRYSDDMMCEECVCHP
LGTNSSAGPCDPSSGQCVCLPNVTGLNCDQCIANHWKIASGEGCEPCNCDPQGSLRPQCN
LFDGQCECRPGFGGRQCNECVARFWGDPKVECRECKCDARGSRSLQCDMRTGACKCLPGI
GGYNCDRCDRGYLGQAPECIPCGECFDNWDRILQETRNQTMDLINRAGDIKKVGATGAYT
KEFDDMQFQLDEIKQLLSNTHEVDIDAIDKELQDLRTKINETELGSVKELDDSIATTKEN
MLLTDLKLKSLKQRIDDFKNKTKELEMNGTQLQEANVQGALTLIQNAKVKADLAAHKAER
TEETINYAERQIKATESTINETAHNFNQQLKNNEKKLIDLNEKLDSLKQTLPDLNEQICD
GRGDPCDSLCGGAGCATCGVSISCENGAKQQAETALAIANRTEMALREKEAMANDFIRNV
SQINTNETRNIAQETYDKAKGGLMKANDSLNNVLNLVKEVNEFMDRNDTKEDIKNFTQQI
LAMKIELEPDEITNMANKIKEAVQHLTDIDPIIEATKDDLRRVNRLRENAEYAKTNASKI
LTDAADVTSTLENTTIAQDNAQSAIDTAWNDINIVNDRLKQIGSKTQSAQKKTNNTADDL
KKLEEQLNQLQRNITDNGIYANRVVNESSNILEKARTTYDDFNELQAQYSKVQRNLTTSL
DKVQSSKDRANDLFKRAWELVAKVTSTEEEISKLENSSQQATLTNLENILQDLIRRMNGY
NQKIQERVHYYKQCN
Download sequence
Identical sequences TC005184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]