SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC006154 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC006154
Domain Number 1 Region: 676-968
Classification Level Classification E-value
Superfamily L domain-like 8.5e-39
Family Ngr ectodomain-like 0.0037
Further Details:      
 
Domain Number 2 Region: 1061-1212
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.1e-35
Family Toll/Interleukin receptor TIR domain 0.0000664
Further Details:      
 
Domain Number 3 Region: 456-758
Classification Level Classification E-value
Superfamily L domain-like 7.25e-34
Family Internalin LRR domain 0.02
Further Details:      
 
Domain Number 4 Region: 63-194
Classification Level Classification E-value
Superfamily TRAF domain-like 3.92e-17
Family SIAH, seven in absentia homolog 0.0008
Further Details:      
 
Domain Number 5 Region: 302-391
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000222
Family SIAH, seven in absentia homolog 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC006154
Sequence length 1222
Comment GLEAN_06154
Sequence
MDFRTLSSSESINQIYVRCTSCKNYLSYFPVMLTQEETLCGRCPSKNNSIRNVSYEALAQ
FVAFPCRYQPQGCCDKFPPGEIPEHEDNCEFRVVPCPLDESVACKWQGPRTELLHHCLDE
HSDLVLENGKFELSLTGSGNFVNVIEFEKVLLIFKRSFDLERKLLKFALYRSKHDLGNQQ
FLCRLEIKGENNTVSGDFDSSLEANYKMGEIRLEAIMCVTSMAVGKLMIKKLNQKNTKVD
EKMLTLLKCIKCSNYAVPPIHYCTEKSNVVCSECRENHGCNSCKRSAPTRNISLDGLASL
LTYPCKYKRNGCTFASKCELINEHNDSCEMSDLLCPFNQTTLNCLWKGTKKQILEHIENK
HPEYLYENNTVISEKFQEGSTYYRVFAKLYVFGQIIIFEKMRIFILLACLASTCSENYCP
PIWQKPTMTQVNETGSILLGEDEFSGCECRAFPASYSFCYGRLNCRTFPRNITISTKTFW
LKASRIPEIKPGDLTILTHLEALTIEGNYNLTRILAGSFLHMKKLQKLCISFNANLKILE
AGCFDGLTSLRHLLLVKNAFTKVAQITPVLVNLPKLRKLDLSENQFSTIDNSDFAVLGNS
YLYELNMILCQIENIEAQAFTHLRNLTVLRLGENSLNISSLAKALDGTTLKSLNLYSIGL
KKNNSRLLLDAIAKTNISFLSLAKNQFEVIKSDTFPLMPKIQTLDLQEVLALNITSNAFV
GFPNLKTLLLSGNRLNSIPDGVLLEKLSCFEVKQNSGNVNNKHSYFSLFGEKFNHMKNLL
QLDLSFNIIQALYNSSFTGLENLRILGLKSATIHRISNGTFSNLSKLVFLNLENNPFVVN
HPLTLESGIFDGLDNLEVLLLGGCGIKFVTNAFKSLKNLVHLGLERNKLMILPNFEGLVK
LQTLDLSQNNIKPWFEPIFATNTHLRDVNLGGNKITYLTPAMVRDLNRLFSLELSENPFT
CDCSFAWDDPKIMKLIENEITLCFFPDSTTGLTIKEFLSEKPDCHNLLIFILPTVFVFLL
ISSFVVVLYYFRWHLRYWLFLTRLHLSRNHKIRHRDTPQGHVNYLYDAFVSYSSEDRNFV
IRLVTMLENYPPYIKLCVYERDFEVGTMISENVLESVAKSRKTLLLISNSYAKSQWCRWE
SQIAEHHRLFFQDENGQYVDDSLILIKLGPVNETYMTPTLKYLLKTRIYLQWDEDEKKQK
VFWEKLRTALAPPGEINENTYL
Download sequence
Identical sequences TC006154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]