SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC006335 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC006335
Domain Number 1 Region: 264-303
Classification Level Classification E-value
Superfamily F-box domain 0.0000249
Family F-box domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC006335
Sequence length 455
Comment GLEAN_06335
Sequence
MIESPSCHAEALQHEIHKSVSSLHQRLVAPPTDLTQKIQQLIHGNTILTYYLRMSWLRKL
SFLNELIKRIKSLDTMRLVIDTLQPLLGKLTSYCKSTTATPMNFDKVLNDHDRMFSGDIL
EENIALDLAWFESIEDQEQVAYLIAFIRLSGHALIRIFIANLQSALVERLKVQALQANHI
DEKEEKKNSSESHYKHDLDDPKHQKCVQLQKKWEKTIGEYRKKVLGKKKEKASTKSKDKK
SKNKKTKKAKKKNKKKRKGGKDEPLDWIQIMPIMIVKKIFNHLDKKSLNRAKKVNTYWKW
AIGELLKDRKARKSLNKSDKKLRKASGSECFFPESEFLEGKARVSHTERRLQKLQMRGAI
LEELRQNSRVAQNTNALITEAMKTFSELAPYVSDLTMYPRVERKNGAIFKRPEFLVKDLG
IICVEGDDLSESEEDTGGQGTRFSSSVASSGSDRF
Download sequence
Identical sequences XP_008196740.1.52716 TC006335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]