SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC007366 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC007366
Domain Number 1 Region: 33-270
Classification Level Classification E-value
Superfamily L domain-like 3.06e-44
Family Leucine rich effector protein YopM 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC007366
Sequence length 349
Comment GLEAN_07366
Sequence
MENYSSDSDTNGNKVFDFAYLLLDSQQLEENLNELGKDCTKREDIESIILHHNQLTTLPK
NLAKFTNVQVLDISNNGLTALPDVFEYWHLTTLVAKNNRFSNESLPKSFAESASLRELNL
SGNVFEQFPEQLFEFTNLKYLYLGGNKIKTIPKNIKKLNCLQILSMGGNQLVEVPSTLGQ
LKQLQALVLCDNLIESLPSNIANLHNLKSLQLHKNKLRTLPPEIIALKNLTELSLRDNPL
VVRFVSNIKHNTASLKELSARVIKLHQMRVEKGDIPASLLNYLDSAHHCVNPYCKGVFFN
SRVEHVKFVDFCGKYRLPLLQYLCSTKCVEDGEELRPPRAYLMKKVLLG
Download sequence
Identical sequences TC007366 XP_975405.2.52716 7070.D2A010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]