SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC007478 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC007478
Domain Number 1 Region: 94-229
Classification Level Classification E-value
Superfamily L domain-like 9.52e-22
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC007478
Sequence length 235
Comment GLEAN_07478
Sequence
MAPNLEENLLNRASKELILFMLPHGPISDDSEEDIDPDIDDSFTFDPSRIHVPLEHNLRA
LLVQVTGTEDLERVTQVKLRVIARDVPLQHLGMFIPALRELILDGSVVATLRELGSTLKN
LKILRINRCGIEVLDNMLALESLEELYAADNSIENCMPCAFLSNLKVLDLRRNRLRDVPR
TLTFLTICEKLEHIYLGGNDEIWQFGNYRQTVKSLLPTLRSLDGITFEDPVKSSP
Download sequence
Identical sequences TC007478 7070.D1ZZB9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]