SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC007602 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC007602
Domain Number 1 Region: 43-235,268-282
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 7.28e-43
Family AlkB-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC007602
Sequence length 297
Comment GLEAN_07602
Sequence
MLLIYSFDGRVRRINLEKTGNSASNFGLNPVKTWEVYELVDHPGLIFIKNPFTSIGQRYW
VVRCLQDYSKRPNKTNLDALNLVPEGKEWWEVCQNNNNKILMNKLRWVTLGYHHDWESKV
YAEENKGEFPKDLAELSRFIAESLNFLHFNAEAAIVNYYHMDSTLSGHTDHSEHNLKAPL
ISLSFGQTAIFLLGGKTKDDEPSAMFLRSGDIVVMSEESRLCYHGVPKILQMDSRFWNCF
EENDFTNDCKNVVNICKEETLWKPFGDYLNNSRININVRQVLQRGQKRLCSESDEKT
Download sequence
Identical sequences TC007602 7070.XP_972787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]