SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC007671 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC007671
Domain Number 1 Region: 125-304
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.98e-38
Family AlkB-like 0.0018
Further Details:      
 
Domain Number 2 Region: 336-484,525-569
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.57e-21
Family UbiE/COQ5-like 0.0072
Further Details:      
 
Domain Number 3 Region: 18-109
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000591
Family Canonical RBD 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC007671
Sequence length 582
Comment GLEAN_07671
Sequence
MESNNSRKKLIKKLRKHQHTVGKETGVVCTDSPTKNLVICNTGQINGLTEEIIVEHFEKY
GHLDRVLLVPGKSCAFLSYKDTSSASEALEAVSGKLNIAQDGKPIFLSFVEALPEIRDAK
IWGRLPPGLRIITNFVSEEEEARLLALCQFEDGGSMKHRLVKHYGYEFRYDINNVDKEKP
LSEGIPQECDFLWRRLPFEFRPNQLTINRYNPGQGIPSHVDTHSAFGDPILSLSLSSDVV
MEFKKDETICVLLPRRSLLVMAGESRYEWTHGIVPRTFDFYNDEGGCHCFKRGVRVSFTF
RKIRKGGCNCSYKLQCDSQTATKIIESDLLAHKLENQHVHDVYEDIAGHFSETRHTPWPN
VLNFVQKLEIGAVLVDVGCGNGKYFGHNRQIVELGTDRSFKLNNLCKHRGFEVFTGNCLN
LPLKNSSADAVISIAVIHHLSTPERRLKALKEIVRILRIGGEALIYVWAKQQIKNDEKST
YIKQDRKNRKKEVIGSVTKEEVSVGEGVTLPVHTNRANFTHSDVLVPWKLKGEEQERTFL
RFYHVFEEGELESLCQSIGNVSIVKSYYDQGNYCVQFVKNNK
Download sequence
Identical sequences D2A2C2
XP_974935.1.52716 TC007671 7070.XP_974935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]