SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC007882 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC007882
Domain Number 1 Region: 108-204
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000731
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 283-396
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000111
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 3 Region: 206-299
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000663
Family I set domains 0.024
Further Details:      
 
Domain Number 4 Region: 27-105
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000298
Family I set domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC007882
Sequence length 416
Comment GLEAN_07882
Sequence
MAVCLVGLVLLALALDAGGFYISQKSATKVVNNETFIVFCRDDVGGLPIKWRNQKGEILG
PKTRPAVHNTSYGTSIMFTNPLRVEDSGNYTCSTGKEERVFQFLVDAPLKFTDTSTNQTA
VEGSEFNLKCEVKGGSTSWSMDEGSAITDNAKYAVLGDGLLIRNVTRSDSKTYICKGVQP
STGTVLDRPIHLHVLHKPVHPNHPQRHVRQEVIYGYINGTANLTCVTIANPPATFVWKKH
RDPKKKIGKTISESDEISILQLHIRDKSFFDNYTCIARNKYGVYEEHFTLKEGARPLPPS
QLQLEEIKSKSLIFKIHGPANSSEMDLGTKGFNVKYKKIDDNEWKQKDFNITQDNLYSLE
GLEPNTEYEVQAATRNAAGLSVYVSSSTYTTSRGAAVHSTLPHVLGAAIISLKFFW
Download sequence
Identical sequences D2A2M5
7070.D2A2M5 TC007882 XP_008191811.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]