SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC007936 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC007936
Domain Number 1 Region: 135-442
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 4.81e-66
Family Asparaginyl hydroxylase-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC007936
Sequence length 568
Comment GLEAN_07936
Sequence
MPPTKNPDLQSVSAFLMYRKTSTNKEITKKRKNLKKNKKSQNIKKKIEEEITKTLPLKPS
RRHSHSIKKTRDNQPEQIKKPLPSKKVNVRHSPERDFLPSRKLNGNHNQDSCDESITQSG
FLPVDDPTEDAQKLFEWLIQPLSPASFFKTYWEQKPLYIKRGNRSYYTHILDSSSLDKIL
RNNSLFFTRNVDVVTYENGEKQVFNQEGRATPSALWDYYGNGCSIRVLNPQTYNHKVHLL
LATLQEYFGTMVGANVYLTPPGSQGFAPHYDDIEAFVVQLEGRKHWKLYQPKSEDVLARF
SSPNFKREDLGEPFMELTLNAGELLYFPRGTIHEGRTDEDSHSLHITVSVYQQTSYVDLL
EHILPKALKKAADSDVEFRKGLPLNYLKDFGLAAGSKNRKFVTSKIKDLMNSLINYVDID
SAADQLGKKFMHDSMPPVLTKSEAERSSKADGPVLKDGVVKNRVEIDLDTRVRLLRYYCI
RLVCEENSSPKLYYNTQNATVYHGEEEQWLELEPSMVPLIQMLQNTYPRYIEVEKLPLDD
MATKMQLVLDLWEHGLLVTEYPLDVIEY
Download sequence
Identical sequences D2A374
XP_974397.2.52716 7070.XP_974397 TC007936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]