SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC008116 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC008116
Domain Number 1 Region: 1415-1736
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 5.1e-21
Family All0351-like 0.043
Further Details:      
 
Weak hits

Sequence:  TC008116
Domain Number - Region: 1105-1184
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00018
Family Pre-dockerin domain 0.056
Further Details:      
 
Domain Number - Region: 855-879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family EGF-type module 0.058
Further Details:      
 
Domain Number - Region: 955-980
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00283
Family Integrin beta EGF-like domains 0.077
Further Details:      
 
Domain Number - Region: 824-847
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00304
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 924-949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0089
Family Integrin beta EGF-like domains 0.096
Further Details:      
 
Domain Number - Region: 788-814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00963
Family EGF-type module 0.073
Further Details:      
 
Domain Number - Region: 759-783
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0115
Family EGF-type module 0.08
Further Details:      
 
Domain Number - Region: 982-1017
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0272
Family Integrin beta EGF-like domains 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC008116
Sequence length 2957
Comment GLEAN_08116
Sequence
MNRLNGRLATAPPADPTQDFEPSCLVRTPSGNVYIPSGTLNHPKNSTIDYKSNSSCSSPS
KDMKNSDRCGIPYGAQVPVLPVRNNLRRPNSSHFPQASRFHFRKGIASKCTWKCAAIVCI
MLSLVLTAALTYISASSVLNWSYQSTKPCSVLVGENTQFVPPSKTATSETNLSTSSRPKT
SSSGGNFLALVYPRKRRQVYNPPHAFVLSNTSDSTTVDFPSLSTTEHDIDREHASTPESL
HDTTNVTGTPLSSVTNSPTDETKNTQIQKGHNVTTTAPPDPEVPNDSDDSSKTTTVLPTT
TDNYQFDGSDESHSFLETSQLQDDPDSFFSDVTLDEETKLEVEDQATDDVKAPIFSYGQD
EVEIVKLNQEPLSTTMKSKTNYSIPRDKNSESKELTESNLSALPNPGADLPLKQPSNFND
PLLLHGLHNVTNPQSVTKQFEAKELPPNPKIQVIEVPPVASTGSTSKRVLVNVTIATDPD
SNNPHATQSVYVLSVSVPTDDGVNQATKHSFQKEEGDKRTTQTPDEKRDGLWGGACECSC
PSCMEASNEFADANSTDYDYRDDVSNSNATSSPDFSTSEASSVSGVTDTTETSETWTSSV
CPEVTTKLPPPPTILILEGARTFPAQSFPPDGTTFSQISLGQRLSKEIPPYGYWNMQFYQ
SEAAYVRFDYNIPRGASIGVYARRNALPTHTQYHILEVLSGFKARTTRASHSSVKKEVTH
YMEQGHWFLSLYNDDGDPQEVTFTAAVADDMTHNCPNGCSGKGECLMGHCQCNPGFGGDD
CSESVCPVLCSQRGEYINGECQCNPGWKGKECQLRHDECEVPDCNGHGHCANGKCNCIRG
YKGKFCEEVDCPHPTCSGHGYCVEGSCLCKKGWKGPDCSQMDKDALQCLPDCSGHGTFDL
DTQTCTCEPRWSGEDCSRELCDLDCGNHGHCVSDSCQCDPGWSGEFCNLKQCDPRCNEHG
QCKNGTCLCVTGWNGKHCTMEGCPNSCSSHGQCRFNTDSMWECRCDNGWDGPDCSILLEQ
NCNDSRDNDKDGLVDCEDPECCSNRLCTSSQLCVSSPKPIDILLRKQPPAITASFFERMK
FLIDEGSLQNYARQETFNESRSAVVRGRVITQMGTGLMGVRVSTSTPLEGFTLTRDDGWF
DLLVNGGGAVTLQFGRAPFRPQTHIVFVPWNEVVIIDNVIMTTGEEKPVSALPQPCTAHD
FDTMKPVVLATWKHGFQGACPDRSAILAESQVVQESLRIPGTGLNLVYHSSRAAGYLSTI
QLQLTPETIPPTLNLIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAI
VKVGYEYSDCKTIIWDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYL
KHKPRVILTTMGDGHQRPLDCNDCEGQASKQRLLAPVALAAAPDGSIFVGDFNLVRKILT
DGRVRTVVRLNATRVSYRYHMALSPLDGTLYISDPESHQIIRVRNTEDYSDPDHNWETVV
GSGERCLPGDEAHCGDGALARDAKLAYPKGVAVSNDNVLYFADGTNIRMVDRDGIVTTVI
GNHMHKSHWKPLPCEGTLTIEEVHLRWPTELAINPLDNTLHIIDDHMILQLTLDGRVKVV
AGRPLHCASPASGYDIELATHATLVMPQSLAFSSAGDLYIAESDSQRINRIRVIGTDGKI
GPYAGAESKCNCLERGCDCFEAEHYLASNSKFNTISAVTVSPDGHVHIGDQANYRIRSVM
ASIPDASISREYEIYSPETQEIYIFNRFGQHIATKNILTGETSYVFTYNVNTSNGKLSTV
TDAAGNKVFLLRDYSSQVNSIENTKGQKCRLRMSRMRMLHELSTPDNYNVTFDYHGPTGL
LKTKLDSSGRSYVYNYDEFGRLTSAVTPTGKVISLSFDLSLKGATVKVGQNNKTPISMLI
KGSSVSTKIGDADNKIILLADGSVASNSPWTHSVTTDTVPYNILADKEPLLGESYPVPAK
QRTEIGGDLANRFEWRYFVRPNQNKGKTPKTVSKVGRKLRVNGENLLTLEYDRDTASISV
FMDDKVELLNVTYDRSARPVKWGPRNGVFAEVELEYDRFSRLSNWKWGDLSETYGFDRAG
RLYEIKYGDGSSLVYAFKDMFSSLPLKVTTPRGSDYLLQYDESGALQSLTTPRGHIHTFS
LQTSLGFFKYQYFSPMNRHPYEIIYNDDGQILAKVYPHQSGRVSYVYDASGKLETSLAGM
SSTQYVYHETSSLVKSIEIVEPNFELKQEFKYHAGILKDEKLKFSSKSGLDNAHFKYQYD
GNARLSGIDVDINGKELPQLRLKYNQNLGILEGISDLRVYRNTFNRSVMQDTSKQFFTIT
DYDEHGRIKSILINIKSLDVFRLEVEYDTRNRIKVQKLLVGRDQFLDRISYNTDGHVLQV
VGTNEWQYIYDENGNIIGVIKGREKISLGYDSGDRVVQYGDVEFNSYDNRGFVVRRGEQK
YRYNSRGLLIHAFERDKFQTWYYYDDRGRLISWNDDKGNVTQYLYSNPSTPDLVTHLHFP
KTGRTFRFLYDSRNVLITVEISEQRFYVATDQNGSPLGLFDINANLIKEIRRTPFGSITL
DTNPDFYLPVDFHGGILDPNTKLVYINKRLYDPVVGQWMTPAWEQLATKLTTPTDVFIYR
FNNNDPINSKTTIDYMTNLNSWLKLYGYDMRNMLGSEYISRMVYRPQATITSPQLAPDFG
VISGLQCIVEKVNEKFTDLGFVPKPLLKMEPKTRNLLPRVAYRRSVFGEGVLISRAGSRA
LVSVVEGVNGVVQDVVTSVFNNSFFLNLHFSILDQDVFYFVKDNVLKIRDDLEELRRLGG
MFNVSTHEITDHGATTIKELRLHNPDAVVIIKYGADPEQETHKILRHAHKRAVERAWELE
KQLVAAGFQGRGDWTEEEKEELISHGDVDGYEGVDIHSIHKYPQLADDPGNVAFQRDTKR
KRRKSGSRRGRLHRHES
Download sequence
Identical sequences TC008116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]