SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC008381 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC008381
Domain Number 1 Region: 2-83
Classification Level Classification E-value
Superfamily F-box domain 0.000000000693
Family F-box domain 0.0046
Further Details:      
 
Domain Number 2 Region: 26-57,101-136,182-206
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000179
Family WD40-repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC008381
Sequence length 216
Comment GLEAN_08381
Sequence
MALPPEILEKILINCDGKTLLTARNVCKLWGDLVDYLSKKTPLWRWCCHEEIPKKELTQY
LIHYNKEEPNIWFYIYKNWMTWQNIHDIRFETVLSPAEIPRITCIDVFEEYIAVGSEDGR
VRIYDQYWKPLVITRHQAEKVSKVTFFYSDRAENLVDKEYMEVIMLEGGSKYVKKLFNTT
EVLEATITCICLYGNTLVLGVDTGIVSTTLILITED
Download sequence
Identical sequences 7070.D2A1E7 TC008381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]