SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC008595 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC008595
Domain Number 1 Region: 1-127
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-25
Family YWTD domain 0.0000909
Further Details:      
 
Domain Number 2 Region: 134-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000428
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC008595
Sequence length 298
Comment GLEAN_08595
Sequence
MYWTDWGHKPHIARALMDGTNGSSFISSDIHWPNGLTIDYPNSRLYWTDAKLMTLESIRL
DGTDRRIVLNEIVKHPYAIAVFENRLYWSDWSTHSIQSCDKFTGKNHHTIIKEQKEYIYG
ITIYHPNNHKTPHLNPCVHKPCSDICLLSGPQGFTCACPQNKELSSNGFTCRDLEKKQKL
VLGAGNLLIEVEHQVLGRHEVNAMPITVKKMGALTYSSVENVIYVSDLELRKIISVNLHT
EMAKPIDVGSLGHVTAMDYECVCAEYTALSPQESPGFIKPGMIYRHQEAFKCSIFFSI
Download sequence
Identical sequences TC008595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]