SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TC008810 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC008810
Domain Number 1 Region: 195-228
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000357
Family Rho termination factor, N-terminal domain 0.06
Further Details:      
 
Weak hits

Sequence:  TC008810
Domain Number - Region: 117-156
Classification Level Classification E-value
Superfamily SAP domain 0.0458
Family SAP domain 0.01
Further Details:      
 
Domain Number - Region: 73-113
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0667
Family Rho termination factor, N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC008810
Sequence length 429
Comment GLEAN_08810
Sequence
MTLEEIIKLTKGDLKKVGDIIEQISEGNSSSSSTKSHDESKIQSSDKSSPLTHESSSMDK
YFLTPQSNNEIVLNKLSLKKIKTIAKKMGLKNYSQYNSKTKLDLIKLILKEELNAGDWFN
KLNRLNIKKLKSIAEKLDLKIKQNSKKTDLVNQISDNALMSEANLNTVLNEIGSPKLEEI
LEETMSKNESTQNTSLTIKELRKIAKEKNIKGYSKMKKAELLQKINDQPFAFEDSYFTEF
SKKSKIKIIETNAEYTKRWRKHKVYYKVILLKAEDEESSEPDLSGLIMKKITVIREGLNE
MIKIVKEKTNFKEGDLLNIVVNHNDLRSPISTGLSRTSDIDNLLNKIQSILTSNQDLDIY
GCTFHAEVVNMPRGATNAKRLINIAEDSRTKRSVTPLGECVCRRGNRVGARPDVSTSAMC
CLPHRKQTT
Download sequence
Identical sequences TC008810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]