SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC009492 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC009492
Domain Number 1 Region: 160-471
Classification Level Classification E-value
Superfamily RNI-like 1.23e-48
Family Cyclin A/CDK2-associated p19, Skp2 0.017
Further Details:      
 
Domain Number 2 Region: 83-136
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000262
Family F-box domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC009492
Sequence length 474
Comment GLEAN_09492
Sequence
MAVTEISSGKNYYGLARFCGPFIRCLLIHIAVVPTMMEEMFTELPVPLLSTAAIIRHHTR
YQPYQRLHQPQHFHTPVQELHALQQPDHGTTHISCLYPEILAIIFSYLEVRDKGRVAQVC
TAWRDAAYNKSVWRGVEAKLHLRRANPSLFASLVKRGIKRVQVLSLRKSLRDVIQGIPNL
ESLNLRGCYNVGDVGISHAFVADSPTLTELDLSLCKQVTDTSLTRIAQHLKNLEVLELGG
CSNVTNSGLMLIAWGLKKLKRLNLRSCWHVGDQGIQHLASGNPSLEHLGLQDCQKLSDEA
LKHATGLTSLISINLSFCVSITDSGLKHLAKMTNLRELNLRSCDNISDTGMAFLAEGGSR
ISSLDVSFCDKIGDQALVHISQGLFNLRNLLMSACQLSDEGLAKIANSLHDLETLNIGQC
SRVTDKGLTTIAESLLRLKCIDLYGCTRITTVGLERIMKLPQLSVLNLGLWHVR
Download sequence
Identical sequences TC009492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]