SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC009605 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC009605
Domain Number 1 Region: 425-668
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.83e-87
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000152
Further Details:      
 
Domain Number 2 Region: 672-959
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.08e-56
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00018
Further Details:      
 
Domain Number 3 Region: 55-146,175-216
Classification Level Classification E-value
Superfamily Fibronectin type III 9.88e-16
Family Fibronectin type III 0.0061
Further Details:      
 
Weak hits

Sequence:  TC009605
Domain Number - Region: 303-339
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0086
Family Fibronectin type III 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC009605
Sequence length 969
Comment GLEAN_09605
Sequence
MEENDLKTSQFIKTPWILKNSLESNFNKVILDERWEGTTLNNLEAEDKSNKWANTNLINF
GQIAHTTIDHLKADTKYFVRAVIKSANGTIYSEYIESFNVFTTKCKVPQQISDLIIINNS
ETSIDIKWPKPKLINGQFKNYVVEYQVNVLTTISEFNVIIVFQRVSSLACNQSFSAPTSK
NTFTTTGDSTRIQKLTPYSNYSISVFVTNSKFKGPPQIKHESTMSSNIIKMNEVPKISEI
KTSHYRARIMFSETRCDEMNGPLWWRVKIMNRMILDQLNQLQLLRKQVAAPLYLNYKNNL
NSDEIQPTTSYRLQIAACNERGEGEFLTGDNTSPPDVPKVDLHTESSNETITVKFDTNEL
RGKTDSLRLLLFISEKSGNAKLENNIKPKIPSKCIKIMEFEMYVKESIQSGELDRQHALF
PRGQTKPWNYGSLKENKSKNRYNNLIAYDHSRVILQKIKGDSYSDYINASYIDGHKISKA
YIATQGPKAVTLNDFWRMVWEQNVMHIANLANVYEGGKKKVEKYWPDINETLQFGTISVQ
HLSTQVFADYEHRFFSVCQNNEIRKIDQLHFMSWPDHGVPLYSQSLVPFLQKLLKFPLST
YSPIVVHCSAGVGRTGTILLCDICLRMAAREGTIDVLRNLEHLRQQRANMVDNIEQYKLA
HLVILECLVGMHTSIGCTEIKDSVNRILANGTATLQMRYLKNTQWQDQAMKTVAQIVEEV
PIIEEKNRFKGIIPEIQGRVFLSRFPSEDETSSYINAVKVDGFRSPGRFIVTQQPMPNTL
GDFWRLVEENDIRVILSLNDVNLKNKTSCRFWPTRSNPEMTPVPHITLKYLKNDLSESYN
ITTVQLIANSRKEQFSVQIISVKHWTSGNNCPDNIGNFLTFWQESDAISRRSNPILVTCY
DGVTASGLYVALSFVIEKMNLEQVCDVCQAVRSVRHNREQFVQNVEQFEFLYKAALLYID
RFESYANFN
Download sequence
Identical sequences TC009605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]