SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC010012 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC010012
Domain Number 1 Region: 34-183
Classification Level Classification E-value
Superfamily L domain-like 6.12e-34
Family Internalin LRR domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC010012
Sequence length 187
Comment GLEAN_10012
Sequence
MSKPTTIKEAIKKWEEKHPGKNIADAEDVGFQFQWPPIEKMDNSLSALTKCRKLSLSTNM
IEKIAGISSLKNLRILSLGRNYIKSFAGLEGVGDSLEELWISYNFIEKMKGVHVLKKLKV
LYMSNNMVKEWSEFMKLQELPSLEDLLFVGNPLYESMEESVWKNEAIKRLPNLKKLDGEP
VVRDEGD
Download sequence
Identical sequences D6WR95
TC010012 7070.XP_975555 XP_975555.3.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]